PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100266590021
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family G2-like
Protein Properties Length: 288aa    MW: 32632.8 Da    PI: 10.1515
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100266590021genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like103.11.7e-3255108255
                       G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                   prlrWtpeLH +Fv+ave+LGG+ekAtPk +l+lm+vkgL+++hvkSHLQ+YR+
  Ote100266590021|100266590021  55 PRLRWTPELHLCFVHAVERLGGEEKATPKLVLQLMNVKGLSIAHVKSHLQMYRS 108
                                   8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.0E-3151109IPR009057Homeodomain-like
PROSITE profilePS5129412.85251111IPR017930Myb domain
SuperFamilySSF466898.24E-1652109IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-2355110IPR006447Myb domain, plants
PfamPF002496.8E-1056107IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MQRAITNSEI DEEMENSKIE KESKRNSSSN STVEENNGKK GSSGSVRQYV RSKTPRLRWT  60
PELHLCFVHA VERLGGEEKA TPKLVLQLMN VKGLSIAHVK SHLQMYRSKK IDDPSEVISQ  120
QRLLLDAGDR HVYNLSQLPM LQSFNQPPIS SLRFRDAILS SQNNNVYQSR DSWKFLENDH  180
KNLMNQRFWQ THQTVTSLLT SKAHSLHTPL NLRPREGTPL QEEGSSILKR KFSPEVNLDL  240
SLSLRTTAQS NEKKMKTTQV DSSLSLSLSS PSKETIHGGI SNSLDLSL
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00301DAPTransfer from AT2G40260Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011076824.11e-96PREDICTED: uncharacterized protein LOC105160975
TrEMBLA0A068UZK87e-72A0A068UZK8_COFCA; Uncharacterized protein
STRINGPGSC0003DMT4000772178e-64(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA85732129